Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.16)
Uniprot AC: Q8RQE8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 1064-1271
Organism: Thermus thermophilus
Interaction Mode:  H-Bb L-Bb 

Sequence:
GLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLF
QPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEI
QEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHT
GGVAGAADITQGLPRVIELFEARRPKAK
Structures of the domain Q8RQE8 1064-1271
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2o5j X-ray 3 D 1064-1265  H-Bb L-Bb 
2o5j X-ray 3 N 1064-1265  H-Bb 
4wqs X-ray 4.31 D 1064-1264 None


© NPIDB team 2003 - 2020

text