Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.11)
Uniprot AC: Q8RQE8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 431-618
Organism: Thermus thermophilus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
VYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRA
KARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINR
NNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGK
QGRFRQNL
Structures of the domain Q8RQE8 431-618
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5e17 X-ray 3.2 D 479-618  H-Bb 
5x21 X-ray 3.32 D 479-618  H-Bb 
4g7z X-ray 3.81 N 479-618 None
4g7z X-ray 3.81 D 479-618 None
4g7o X-ray 2.99 N 479-618  H-Bb L-Bb 
4g7o X-ray 2.99 D 479-618  H-Bb L-Bb 
4g7h X-ray 2.9 N 479-618  H-Bb 
4g7h X-ray 2.9 D 479-618 None
4oiq X-ray 3.62 D 479-618  H-Bb 
4q4z X-ray 2.9 D 479-618  H-Bb 
4oip X-ray 3.4 D 479-618 None
4oir X-ray 3.1 D 479-618  H-Bb 
4oin X-ray 2.8 D 479-618 None
4oio X-ray 3.1 D 479-618 None
4q5s X-ray 3 D 479-618 None
5d4c X-ray 3.28 D 479-618 None
5d4c X-ray 3.28 N 479-618 None
5d4d X-ray 3 D 479-618  H-Bb 
5d4d X-ray 3 N 479-618  H-Bb 
5d4e X-ray 3.08 D 479-618  H-Bb 
5d4e X-ray 3.08 N 479-618  H-Bb 
5voi X-ray 2.8 D 479-618  L-Bb 
5e18 X-ray 3.3 D 479-618  H-Bb 
5x22 X-ray 3.35 D 479-618  H-Bb H-Mj 
5x22 X-ray 3.35 N 479-618  H-Bb 
5vo8 X-ray 3.3 D 479-618 None


© NPIDB team 2003 - 2019

text