Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.17)
Uniprot AC: Q8RQE8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 768-954
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
NLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPI
KVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVA
EAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGI
TIGIDDA
Structures of the domain Q8RQE8 768-954
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5e17 X-ray 3.2 D 768-953 None
5i2d X-ray 4.41 D 768-953 None
5i2d X-ray 4.41 O 768-953 None
3aoh X-ray 4.1 D 768-953 None
3aoh X-ray 4.1 N 768-953 None
3aoh X-ray 4.1 I 768-953 None
2o5i X-ray 2.5 D 768-953 None
2o5i X-ray 2.5 N 768-953 None
3aoi X-ray 4.3 D 768-953 None
3aoi X-ray 4.3 I 768-953 None
3aoi X-ray 4.3 N 768-953 None
2ppb X-ray 3 N 768-953 None
2ppb X-ray 3 D 768-953 None
5x21 X-ray 3.32 D 768-953 None
2o5j X-ray 3 D 768-953 None
2o5j X-ray 3 N 768-953 None
4g7z X-ray 3.81 N 768-953 None
4g7z X-ray 3.81 D 768-953 None
4g7o X-ray 2.99 N 768-953 None
4g7o X-ray 2.99 D 768-953 None
4g7h X-ray 2.9 N 768-953 None
4g7h X-ray 2.9 D 768-953 None
4oiq X-ray 3.62 D 768-953 None
4gzy X-ray 3.51 D 768-953 None
4q4z X-ray 2.9 D 768-953 None
4oip X-ray 3.4 D 768-953 None
4oir X-ray 3.1 D 768-953 None
4oin X-ray 2.8 D 768-953 None
4oio X-ray 3.1 D 768-953 None
4q5s X-ray 3 D 768-953 None
4wqs X-ray 4.31 N 768-953 None
4wqs X-ray 4.31 D 768-953 None
5d4c X-ray 3.28 D 768-953 None
5d4c X-ray 3.28 N 768-953 None
5d4d X-ray 3 D 768-953 None
5d4d X-ray 3 N 768-953 None
4gzz X-ray 4.29 D 768-953 None
5d4e X-ray 3.08 D 768-953 None
5d4e X-ray 3.08 N 768-953 None
5voi X-ray 2.8 D 768-953 None
5e18 X-ray 3.3 D 768-953 None
5x22 X-ray 3.35 D 768-953 None
5x22 X-ray 3.35 N 768-953 None
5vo8 X-ray 3.3 D 768-953 None


© NPIDB team 2003 - 2019

text