Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.19)
Uniprot AC: Q8RQE9
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1028-1104
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
GGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRV
LVKELQALALDVQTLDE
Structures of the domain Q8RQE9 1028-1104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5e17 X-ray 3.2 C 1028-1102 None
5i2d X-ray 4.41 C 1028-1102 None
5i2d X-ray 4.41 N 1028-1102 None
3aoh X-ray 4.1 C 1028-1102 None
3aoh X-ray 4.1 M 1028-1102 None
3aoh X-ray 4.1 H 1028-1102 None
2o5i X-ray 2.5 C 1028-1102 None
2o5i X-ray 2.5 M 1028-1102 None
3aoi X-ray 4.3 C 1028-1102 None
3aoi X-ray 4.3 H 1028-1102 None
3aoi X-ray 4.3 M 1028-1102 None
2ppb X-ray 3 M 1028-1102 None
2ppb X-ray 3 C 1028-1102 None
5x21 X-ray 3.32 C 1028-1102 None
2o5j X-ray 3 C 1028-1102 None
2o5j X-ray 3 M 1028-1102 None
4g7z X-ray 3.81 M 1028-1102 None
4g7z X-ray 3.81 C 1028-1102 None
4g7o X-ray 2.99 M 1028-1102 None
4g7o X-ray 2.99 C 1028-1102 None
4g7h X-ray 2.9 M 1028-1102 None
4g7h X-ray 2.9 C 1028-1102 None
4oiq X-ray 3.62 C 1028-1102 None
4gzy X-ray 3.51 C 1028-1102 None
4q4z X-ray 2.9 C 1028-1102 None
4oip X-ray 3.4 C 1028-1102 None
4oir X-ray 3.1 C 1028-1102 None
4oin X-ray 2.8 C 1028-1102 None
4oio X-ray 3.1 C 1028-1102 None
4q5s X-ray 3 C 1028-1102 None
4wqs X-ray 4.31 M 1028-1102 None
4wqs X-ray 4.31 C 1028-1102 None
5d4c X-ray 3.28 C 1028-1102 None
5d4c X-ray 3.28 M 1028-1102 None
5d4d X-ray 3 C 1028-1102 None
5d4d X-ray 3 M 1028-1102 None
4gzz X-ray 4.29 C 1028-1102 None
5d4e X-ray 3.08 C 1028-1102 None
5d4e X-ray 3.08 M 1028-1102 None
5voi X-ray 2.8 C 1028-1102 None
5e18 X-ray 3.3 C 1028-1102 None
5x22 X-ray 3.35 C 1028-1102 None
5x22 X-ray 3.35 M 1028-1102 None
5vo8 X-ray 3.3 C 1028-1102 None


© NPIDB team 2003 - 2019

text