Pfam domain
Pfam family: TBP (PF00352.20)
Uniprot AC: Q8ST28
RecName: TRANSCRIPTION INITIATION FACTOR TFIID (TFIID-1)
Begin-End: 23-104
Organism: Encephalitozoon cuniculi
Interaction Mode:  S-Bb S-Mn L-Bb 

Sequence:
PTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVIT
GAKSEKSSRMAAQRYAKIIHKL
Structures of the domain Q8ST28 23-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wzs X-ray 3.78 D 24-103  S-Bb S-Mn L-Bb 


© NPIDB team 2003 - 2020

text