Pfam domain
Pfam family: FAD_binding_7 (PF03441.16)
Uniprot AC: Q8SXK5
RecName: RE11660p
Begin-End: 296-496
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb L-Bb L-Mj L-Mn 

Sequence:
LIGQLMWREFYYTVAAAEPNFDRMLGNVYCMQIPWQEHPDHLEAWTHGRTGYPFIDAIMR
QLRQEGWIHHLARHAVACFLTRGDLWISWEEGQRVFEQLLLDQDWALNAGNWMWLSASAF
FHQYFRVYSPVAFGKKTDPQGHYIRKYVPELSKYPAGCIYEPWKASLVDQRAYGCVLGTD
YPHRIVKHEVVHKENIKRMGA
Structures of the domain Q8SXK5 296-496
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3cvw X-ray 3.2 A 296-496  H-Bb L-Bb L-Mj L-Mn 
3cvx X-ray 3.2 A 296-496  L-Bb L-Mj L-Mn 
2wb2 X-ray 2.95 A 296-496  H-Bb L-Bb L-Mj L-Mn 
3cvu X-ray 2 A 296-496  H-Bb L-Bb L-Mj L-Mn 
3cvv X-ray 2.1 A 296-496  H-Bb L-Bb L-Mj L-Mn 
2wq7 X-ray 2 A 296-496  H-Bb L-Bb L-Mj L-Mn 
2wq6 X-ray 2.3 A 296-496  H-Bb L-Bb L-Mj L-Mn 
3cvy X-ray 2.7 A 296-496  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text