Pfam domain
Pfam family: Methyltr_RsmB-F (PF01189.16)
Uniprot AC: Q8TEA1
RecName: Putative methyltransferase NSUN6
Begin-End: 227-464
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SHVLNPQPGEKILDLCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNALLLGLNS
IRAFCFDGTKAVKLDMVEDTEGEPPFLPESFDRILLDAPCSGMGQRPNMACTWSVKEVAS
YQPLQRKLFTAAVQLLKPEGVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQEPQIGGE
GMRGAGLSCEQLKQLQRFDPSAVPLPDTDMDSLREARREDMLRLANKDSIGFFIAKFV
Structures of the domain Q8TEA1 227-464
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wws X-ray 3.25 A 229-400 None
5wws X-ray 3.25 B 229-400 None
5wwt X-ray 3.2 A 229-400 None
5wwt X-ray 3.2 B 229-400 None
5wwr X-ray 3.1 A 229-400 None
5wwr X-ray 3.1 B 229-400 None


© NPIDB team 2003 - 2019

text