Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: Q8U004
RecName: 30S ribosomal protein S3
Begin-End: 16-90
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
LIDEFLEKELRRAGYGGLDIKKTPLGTKVIIFAANPGYVIGRGGRRIRELTRILEKQFGL
ENPQIEVEEIKNPYL
Structures of the domain Q8U004 16-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jb3 X-ray 5.34 Z 17-88 None


© NPIDB team 2003 - 2019

text