Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: Q8U0E7
RecName: 30S ribosomal protein S9
Begin-End: 8-135
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
GKRKTAIARAVIREGKGRVRINGKPVEIIEPEIARFTILEPLILAGEEIWNSVDIDVKVE
GGGFMGQAEAARMAIARALVEWTGDMSLKEKFMKYDRTMLVGDPRRTEPHKPNRSTKGPR
AKRQKSYR
Structures of the domain Q8U0E7 8-135
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jb3 X-ray 5.34 K 8-135 None


© NPIDB team 2003 - 2019

text