Pfam domain
Pfam family: Ribosomal_S17e (PF00833.17)
Uniprot AC: Q8U0U1
RecName: 30S ribosomal protein S17e
Begin-End: 1-66
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
MGKIRQGFIKRVARELVNKYPNEFTTDFEHNKKKVQELTNVTSKKIRNRIAGYVTKLVRM
KMEGKI
Structures of the domain Q8U0U1 1-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jb3 X-ray 5.34 S 1-61 None


© NPIDB team 2003 - 2019

text