Pfam domain
Pfam family: Metallophos (PF00149.30)
Uniprot AC: Q8U1N9
RecName: DNA double-strand break repair protein Mre11
Begin-End: 1-210
Organism: Pyrococcus furiosus
Interaction Mode:  H-Bb H-Mn L-Bb L-Mn 

Sequence:
MKFAHLADIHLGYEQFHKPQREEEFAEAFKNALEIAVQENVDFILIAGDLFHSSRPSPGT
LKKAIALLQIPKEHSIPVFAIEGNHDRTQRGPSVLNLLEDFGLVYVIGMRKEKVENEYLT
SERLGNGEYLVKGVYKDLEIHGMKYMSSAWFEANKEILKRLFRPTDNAILMLHQGVREVS
EARGEDYFEIGLGDLPEGYLYYALGHIHKR
Structures of the domain Q8U1N9 1-210
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3dsc X-ray 2.7 A 1-210  H-Bb H-Mn L-Bb 
3dsd X-ray 2.2 A 1-210  L-Bb L-Mn 
3dsd X-ray 2.2 B 1-210  H-Bb H-Mn L-Bb 


© NPIDB team 2003 - 2021

text