Pfam domain
Pfam family: Nop (PF01798.17)
Uniprot AC: Q8U4M1
RecName: NOP5/NOP56 related protein
Begin-End: 137-364
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
ALDDVDKVINLLVARLREWYSLHFPELDELLPKHPQYVAFVKTVGHRDNINEEVLRELGL
SEEKIKKILEAKEKTMGAWMDQTDIEVVRQLAEEIDRLYQLRKKLEDYIDRAMDDVAPNL
KALVGAKLAARLISLAGGLRELAMMPSSTIQVLGAEKALFRHLRTGAKPPKHGVIYQYPA
INRSPWWQRGKIARALAGKLAIAARVDYFSGEYIAEELKKELEARIRE
Structures of the domain Q8U4M1 137-364
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3nvk X-ray 3.21 A 142-367 None
3nvk X-ray 3.21 F 142-367 None
3nmu X-ray 2.73 A 142-367 None
3nmu X-ray 2.73 B 142-367 None
3nmu X-ray 2.73 A 142-367 None
3nmu X-ray 2.73 B 142-367 None
3nvi X-ray 2.71 C 142-367 None
3nvi X-ray 2.71 C 142-367 None
3nvi X-ray 2.71 A 142-367 None
3nvi X-ray 2.71 A 142-367 None
4by9 NMR L 135-360 None
4by9 NMR I 135-360 None
4by9 NMR F 135-360 None
4by9 NMR C 135-360 None


© NPIDB team 2003 - 2019

text