Pfam domain
Pfam family: Fibrillarin (PF01269.16)
Uniprot AC: Q8U4M2
RecName: Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
Begin-End: 4-227
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
VKKHKFPGVYVVIDDDGSEKIATKNLVPGQRVYGERVIKWEGEEYRIWNPHRSKLGAAIV
NGLKNFPIKPGKSVLYLGIASGTTASHVSDIVGWEGKIYGIEFSPRVLRELVPIVEERRN
IIPILGDATKPEEYRALVTKVDVIFEDVAQPTQAKILIDNAKAYLKRGGYGMIAVKSRSI
DVTKEPEQVFKEVERELSEYFEVIERLNLEPYEKDHALFVVRKP
Structures of the domain Q8U4M2 4-227
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3nvk X-ray 3.21 J 5-225 None
3nvk X-ray 3.21 I 5-225 None
3nmu X-ray 2.73 F 5-225 None
3nmu X-ray 2.73 J 5-225 None
3nmu X-ray 2.73 F 5-225 None
3nmu X-ray 2.73 J 5-225 None
4by9 NMR N 5-225 None
4by9 NMR K 5-225 None
4by9 NMR H 5-225 None
4by9 NMR E 5-225 None


© NPIDB team 2003 - 2019

text