Pfam domain
Pfam family: Cucumo_2B (PF03263.12)
Uniprot AC: Q8UYT3
RecName: Suppressor of silencing 2b
Begin-End: 7-58
Organism: Tomato aspermy virus
Interaction Mode:   

Sequence:
PLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELS
Structures of the domain Q8UYT3 7-58
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3cz3 X-ray 3.23 A 13-53 None
3cz3 X-ray 3.23 B 13-53 None
3cz3 X-ray 3.23 C 13-53 None
3cz3 X-ray 3.23 D 13-53 None
2zi0 X-ray 2.82 B 20-53 None
2zi0 X-ray 2.82 B 20-53 None


© NPIDB team 2003 - 2019

text