Pfam domain
Pfam family: Cucumo_2B (PF03263.12)
Uniprot AC: Q8UYT3
RecName: Suppressor of silencing 2b
Begin-End: 7-64
Organism: Tomato aspermy virus
Interaction Mode:   

Sequence:
PLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELSAINSDN
Structures of the domain Q8UYT3 7-64
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2zi0 X-ray 2.82 A 20-56 None
2zi0 X-ray 2.82 A 20-56 None


© NPIDB team 2003 - 2019

text