Pfam domain
Pfam family: RdRP_5 (PF07925.10)
Uniprot AC: Q8V1A3
RecName: Lambda 3 protein (Fragment)
Begin-End: 1-121
Organism: Reovirus sp.
Interaction Mode:   

Sequence:
VGVRAARPISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHT
ANNSTMMETFLTVWGPEHTDDPDVLRLMKSLTIQRNYVCQGDDGLMIIDGTTAGKVNSET
I
Structures of the domain Q8V1A3 1-121
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1uon X-ray 7.6 A 2-1263 None


© NPIDB team 2003 - 2020

text