Pfam domain
Pfam family: Sulf_coat_C (PF12193.10)
Uniprot AC: Q8V9P2
RecName: Uncharacterized protein
Begin-End: 7-134
Organism: Sulfolobus islandicus rod-shaped virus 2
Interaction Mode:   

Sequence:
SRSYSQRYAKWQAKFNAFSNPTVASTILSNVSPVAQQNFQTNVPKFTSVNENVSAVLTQY
GITGPNRAIYQGFGLKVARALNRIGSGPALVNMINGLKGYYISAFNANPQVLDAVVNIIT
GSPTGYVS
Structures of the domain Q8V9P2 7-134
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j9x X-ray 3.8 1 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 2 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 3 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 t 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 l 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 m 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 n 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 4 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 5 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 6 7-134  H-Bb H-Mn 
3j9x X-ray 3.8 p 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 o 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 z 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 u 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 v 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 w 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 x 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 y 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 q 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 s 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 r 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 k 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 j 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 i 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 h 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 g 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 f 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 e 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 d 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 c 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 b 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 a 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 Z 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 Y 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 X 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 W 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 V 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 U 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 T 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 S 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 R 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 Q 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 P 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 O 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 N 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 M 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 L 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 K 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 J 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 I 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 H 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 A 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 B 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 G 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 F 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 E 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 D 7-134  H-Bb H-Mn L-Bb 
3j9x X-ray 3.8 C 7-134  H-Bb H-Mn L-Bb 


© NPIDB team 2003 - 2021

text