Pfam domain
Pfam family: SAD_SRA (PF02182.19)
Uniprot AC: Q8VZ17
RecName: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6
Begin-End: 328-486
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
ILGEVPGVEVGDEFQYRMELNILGIHKPSQAGIDYMKYGKAKVATSIVASGGYDDHLDNS
DVLTYTGQGGNVMQVKKKGEELKEPEDQKLITGNLALATSIEKQTPVRVIRGKHKSTHDK
SKGGNYVYDGLYLVEKYWQQVGSHGMNVFKFQLRRIPGQ
Structures of the domain Q8VZ17 328-486
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6a5n X-ray 2.4 A 328-486  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text