Pfam domain
Pfam family: Pre-SET (PF05033.18)
Uniprot AC: Q8VZ17
RecName: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6
Begin-End: 510-608
Organism: Arabidopsis thaliana
Interaction Mode:   

Sequence:
ISEGKEQSPISAVNEIDDEKPPLFTYTVKLIYPDWCRPVPPKSCCCTTRCTEAEARVCAC
VEKNGGEIPYNFDGAIVGAKPTIYECGPLCKCPSSCYLR
Structures of the domain Q8VZ17 510-608
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6a5n X-ray 2.4 A 510-608 None


© NPIDB team 2003 - 2021

text