Pfam domain
Pfam family: SET (PF00856.30)
Uniprot AC: Q8VZ17
RecName: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6
Begin-End: 627-760
Organism: Arabidopsis thaliana
Interaction Mode:   

Sequence:
GWGVRCLKSIPIGSFICEYVGELLEDSEAERRIGNDEYLFDIGNRYDNSLAQGMSELMLG
TQAGRSMAEGDESSGFTIDAASKGNVGRFINHSCSPNLYAQNVLYDHEDSRIPHVMFFAQ
DNIPPLQELCYDYN
Structures of the domain Q8VZ17 627-760
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6a5n X-ray 2.4 A 627-760 None


© NPIDB team 2003 - 2021

text