Pfam domain
Pfam family: B3 (PF02362.20)
Uniprot AC: Q8W4L5
RecName: B3 domain-containing transcription repressor VAL1
Begin-End: 295-396
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
FEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQDVRGREWTFQFRYWPNNNS
RMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGGKLIMGSRKAA
Structures of the domain Q8W4L5 295-396
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5yzz X-ray 2.58 C 295-391  H-Bb H-Mj S-Bb S-Mj L-Mj 
5z00 X-ray 2.59 C 295-391  H-Bb S-Bb S-Mj L-Bb L-Mj 
5z00 X-ray 2.59 G 295-391  H-Bb S-Bb S-Mj L-Bb L-Mj 
5z00 X-ray 2.59 M 295-391 None
5z00 X-ray 2.59 K 295-391  H-Bb H-Mj S-Bb S-Mj L-Mj 
6fas X-ray 1.9 A 295-391  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
6fas X-ray 1.9 B 295-391  S-Bb S-Mj L-Bb L-Mj 
5yzy X-ray 2.61 C 295-391  H-Bb H-Mj S-Bb S-Mj L-Mj 


© NPIDB team 2003 - 2019

text