Pfam domain
Pfam family: Topo_C_assoc (PF14370.5)
Uniprot AC: Q8WQM6
RecName: DNA topoisomerase I-like protein
Begin-End: 211-262
Organism: Leishmania donovani
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
KAVSLGTSKINYIDPRIICSWAKAQDVPINKIFSATIQKKFPWAMNAENFDF
Structures of the domain Q8WQM6 211-262
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2b9s X-ray 2.27 B 211-262  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2020

text