Pfam domain
Pfam family: STAG (PF08514.13)
Uniprot AC: Q8WVM7
RecName: Cohesin subunit SA-1
Begin-End: 160-274
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GDYPLTMPGPQWKKFRSNFCEFIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFR
HTSTLAAMKLMTALVNVALNLSIHQDNTQRQYEAERNKMIGKRANERLELLLQKR
Structures of the domain Q8WVM7 160-274
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wg3 X-ray 5.3 D 160-274 None


© NPIDB team 2003 - 2021

text