Pfam domain
Pfam family: Prp31_C (PF09785.8)
Uniprot AC: Q8WWY3
RecName: U4/U6 small nuclear ribonucleoprotein Prp31
Begin-End: 337-448
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSL
GHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGT
Structures of the domain Q8WWY3 337-448
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 H 338-437 None


© NPIDB team 2003 - 2019

text