Pfam domain
Pfam family: Nop (PF01798.17)
Uniprot AC: Q8WWY3
RecName: U4/U6 small nuclear ribonucleoprotein Prp31
Begin-End: 99-330
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQI
LTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPN
LSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSD
IVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDK
Structures of the domain Q8WWY3 99-330
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ozb X-ray 2.6 B 100-330 None
2ozb X-ray 2.6 E 100-330 None
3siu X-ray 2.63 B 100-330 None
3siu X-ray 2.63 E 100-330 None
3siv X-ray 3.3 E 100-330 None
3siv X-ray 3.3 B 100-330 None
3siv X-ray 3.3 K 100-330 None
3siv X-ray 3.3 H 100-330 None
3jcr X-ray 7 J 100-330 None
5o9z X-ray 4.5 H 100-330 None


© NPIDB team 2003 - 2019

text