Pfam domain
Pfam family: 5_3_exonuc_N (PF02739.15)
Uniprot AC: Q8X6R9
RecName: Flap endonuclease Xni
Begin-End: 4-159
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
HLLIVDALNLIRRIHAVQGSPCVETCQHALDQLIMHSQPTHAVAVFDDENRSSGWRHQRL
PDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQATI
VSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFG
Structures of the domain Q8X6R9 4-159
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3zdb X-ray 1.47 A 5-146 None
3zda X-ray 1.5 A 5-146 None
3zdc X-ray 1.53 A 5-146 None


© NPIDB team 2003 - 2019

text