Pfam domain
Pfam family: Flu_PA (PF00603.16)
Uniprot AC: Q91R78
RecName: Polymerase acidic protein
Begin-End: 259-714
Organism: Influenza A virus (A/goose/Guangdong/3/1997(H5N1))
Interaction Mode:   

Sequence:
PFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMKTFFGWK
EPNIVKPHEKGINPNYLLAWKQVLAELQDIENEEKIPKTKNMRKTSQLKWALGENMAPEK
VDFEDCKDVSDLRQYDSDEPKPRSLASWIQSEFNKACELTDSSWIELDEIGEDVAPIEHI
ASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKT
NLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRTAIGQVS
RPMFLYVRANGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSET
WPIGESPKGMEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIVQALRDNLEP
GTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHA
Structures of the domain Q91R78 259-714
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j9b X-ray 4.3 A 394-714 None
3j9b X-ray 4.3 H 394-714 None


© NPIDB team 2003 - 2019

text