Pfam domain
Pfam family: HhH-GPD (PF00730.24)
Uniprot AC: Q92383
RecName: DNA-3-methyladenine glycosylase 1
Begin-End: 55-201
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
IRAVASQQLHSKAANAIFNRFKSISNNGQFPTPEEIRDMDFEIMRACGFSARKIDSLKSI
AEATISGLIPTKEEAERLSNEELIERLTQIKGIGRWTVEMLLIFSLNRDDVMPADDLSIR
NGYRYLHRLPKIPTKMYVLKHSEICAP
Structures of the domain Q92383 55-201
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3s6i X-ray 2.28 A 55-200 None
3s6i X-ray 2.28 D 55-200 None


© NPIDB team 2003 - 2019

text