Pfam domain
Pfam family: Linker_histone (PF00538.21)
Uniprot AC: Q92522
RecName: Histone H1.10
Begin-End: 45-117
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQ
VKGTGANGSFKLN
Structures of the domain Q92522 45-117
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7k60 X-ray 3.12 U 44-116  H-Bb S-Bb S-Mn L-Bb 


© NPIDB team 2003 - 2021

text