Pfam domain
Pfam family: Tfb2 (PF03849.13)
Uniprot AC: Q92759
RecName: General transcription factor IIH subunit 4
Begin-End: 28-274
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEEST
GLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPS
LDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLD
TPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLRE
FGLVFQR
Structures of the domain Q92759 28-274
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 2 141-390 None
5iy8 X-ray 7.9 2 141-390 None
5ivw X-ray 10 2 141-390 None
5iy6 X-ray 7.2 2 141-390 None
5iy9 X-ray 6.3 2 141-390 None


© NPIDB team 2003 - 2019

text