Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: Q92826
RecName: Homeobox protein Hox-B13
Begin-End: 217-273
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK
Structures of the domain Q92826 217-273
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ego X-ray 2.54 B 217-273  H-Bb H-Mj 
5eea X-ray 2.2 B 217-273  H-Bb H-Mj L-Bb L-Mn 
5eea X-ray 2.2 A 217-273  H-Bb H-Mj L-Bb L-Mn 
5eea X-ray 2.2 G 217-273  H-Bb H-Mj L-Bb L-Mn 
5eea X-ray 2.2 J 217-273  H-Bb H-Mj L-Bb L-Mn 
5ef6 X-ray 3 J 217-273  H-Bb H-Mj L-Bb L-Mn 
5ef6 X-ray 3 G 217-273  H-Bb H-Mj L-Bb L-Mn 
5ef6 X-ray 3 B 217-273  H-Bb H-Mj L-Bb L-Mn 
5ef6 X-ray 3 A 217-273  H-Bb H-Mj L-Bb L-Mn 
5eg0 X-ray 3.1 B 217-273  H-Bb H-Mj L-Bb L-Mn 
5edn X-ray 3.2 J 217-273  H-Bb H-Mj L-Bb L-Mn 
5edn X-ray 3.2 G 218-273  H-Bb H-Mj L-Bb 
5edn X-ray 3.2 B 217-273  H-Bb H-Mj L-Bb L-Mn 
5edn X-ray 3.2 A 217-273  H-Bb H-Mj L-Bb L-Mn 
5no6 X-ray 2.88 B 217-273  H-Bb H-Mj L-Bb L-Mn 
5no6 X-ray 2.88 A 217-273  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text