Pfam domain
Pfam family: Recombinase (PF07508.12)
Uniprot AC: Q928V6
RecName: Putative integrase [Bacteriophage A118]
Begin-End: 171-254
Organism: Listeria innocua serovar 6a
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
EEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVH
VKGIHEPIISEEQFYRVQEIFSRM
Structures of the domain Q928V6 171-254
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kis X-ray 3.2 D 171-252  H-Bb H-Mj L-Bb L-Mj 
4kis X-ray 3.2 C 171-252 None
4kis X-ray 3.2 B 171-252 None
4kis X-ray 3.2 A 171-252 None


© NPIDB team 2003 - 2019

text