Pfam domain
Pfam family: Zn_ribbon_recom (PF13408.5)
Uniprot AC: Q928V6
RecName: Putative integrase [Bacteriophage A118]
Begin-End: 267-333
Organism: Listeria innocua serovar 6a
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEE
LIIDRVN
Structures of the domain Q928V6 267-333
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kis X-ray 3.2 D 267-332  H-Bb S-Bb S-Mj L-Bb L-Mj 
4kis X-ray 3.2 C 267-332 None
4kis X-ray 3.2 B 267-332 None
4kis X-ray 3.2 A 267-332 None


© NPIDB team 2003 - 2019

text