Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q93077
RecName: Histone H2A type 1-C
Begin-End: 16-91
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK
KTRIIPRHLQLAIRND
Structures of the domain Q93077 16-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6c0w X-ray 4 G 17-88 None
6c0w X-ray 4 C 16-88 None


© NPIDB team 2003 - 2019

text