Pfam domain
Pfam family: Y1_Tnp (PF01797.15)
Uniprot AC: Q933Z0
RecName: IS200/IS605 family transposase
Begin-End: 14-131
Organism: Helicobacter pylori
Interaction Mode:   

Sequence:
VYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEIIEMQTDKDHIHILADIDP
SFGVMKFIKTAKGRSSRILRQEFNHLKTKLPTLWTNSCFISTVGGAPLNVVKQYIENQ
Structures of the domain Q933Z0 14-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vjv X-ray 1.9 A 14-130 None
2vjv X-ray 1.9 B 14-130 None
2vic X-ray 2.35 A 14-131 None
2vic X-ray 2.35 B 14-131 None
2a6o X-ray 2.6 B 14-131 None
2a6o X-ray 2.6 A 14-131 None
2vih X-ray 2.1 A 14-131 None
2vih X-ray 2.1 B 14-131 None
2vhg X-ray 2.9 A 14-131 None
2vhg X-ray 2.9 B 14-131 None
2vju X-ray 2.4 A 14-131 None
2vju X-ray 2.4 B 14-131 None
6fi8 X-ray 2.6 B 14-131 None
6fi8 X-ray 2.6 A 14-131 None
6fi8 X-ray 2.6 H 14-130 None
6fi8 X-ray 2.6 G 14-131 None


© NPIDB team 2003 - 2019

text