Pfam domain
Pfam family: N6_Mtase (PF02384.15)
Uniprot AC: Q93R01
RecName: Endonuclease and methylase LlaGI
Begin-End: 840-1106
Organism: Lactococcus lactis
Interaction Mode:   

Sequence:
DKQKIIVTLYDKFFKTAFKATTERLGIVFTPIEVVDFIVHSVDDVLKKHFGKSLASKDVH
ILDPFTGTGTFIVRTLTYLKEQMDAGEISLSDITRKFMKELHANEIVLLSYYIAAINIEA
TFDEINGEEEGYVPFEGIVLTDTFESTETEETLDDDYFGTNDERLKRQQEVPITAIIGNP
PYSKGQSNENDNNKNIEYPRLFKSIADSYVKNSKTTSVLGMYDSYVLSIRWASNRLNDKG
VIGFVSNGSYIDSQSADGLRKSLFKEF
Structures of the domain Q93R01 840-1106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ffj X-ray 2.84 A 867-1037 None
5ffj X-ray 2.84 B 867-1037 None


© NPIDB team 2003 - 2020

text