Pfam domain
Pfam family: C_LFY_FLO (PF17538.4)
Uniprot AC: Q94IF5
RecName: FLORICAULA/LEAFY homolog 1
Begin-End: 189-346
Organism: Physcomitrella patens subsp. patens
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
PREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQHIAKEKGEKCPSKVTNEVFR
HAKLTGAGYINKPKMRDYVHCYALHCLDVETSNNLRKEYKERGENVGAWCQACYFPLVKL
ARQNEWDIDDLFNRNDKLRIWYVPTKLRQLCHIERMKH
Structures of the domain Q94IF5 189-346
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4bhk X-ray 2.32 A 189-346  H-Bb H-Mj L-Bb L-Mn 
4bhk X-ray 2.32 B 189-346  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text