Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: Q96A08
RecName: Histone H2B type 1-A
Begin-End: 35-103
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSR
EIQTAVRLL
Structures of the domain Q96A08 35-103
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3wkj X-ray 2.8 H 35-101  H-Bb S-Bb L-Bb 
3wkj X-ray 2.8 D 33-101  H-Bb H-Mj S-Bb L-Bb 
5gt3 X-ray 2.91 D 31-100  H-Bb H-Mj S-Bb L-Bb 
5gt3 X-ray 2.91 H 35-100  H-Bb S-Bb L-Bb 
5gsu X-ray 3.1 H 30-98  H-Bb L-Bb 
5gsu X-ray 3.1 D 28-98  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text