Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: Q96A35
RecName: 39S ribosomal protein L24, mitochondrial
Begin-End: 91-154
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRS
GRII
Structures of the domain Q96A35 91-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 V 92-154 None
5oom X-ray 3.03 V 92-154 None


© NPIDB team 2003 - 2019

text