Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: Q96DI7
RecName: U5 small nuclear ribonucleoprotein 40 kDa protein
Begin-End: 186-221
Organism: Homo sapiens
Interaction Mode:   

Sequence:
AIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWD
Structures of the domain Q96DI7 186-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 D 319-351 None
3jcr X-ray 7 D 59-94 None
3jcr X-ray 7 D 103-137 None
5o9z X-ray 4.5 D 319-351 None
5o9z X-ray 4.5 D 7-42 None


© NPIDB team 2003 - 2019

text