Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: Q96DI7
RecName: U5 small nuclear ribonucleoprotein 40 kDa protein
Begin-End: 271-313
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWD
Structures of the domain Q96DI7 271-313
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 D 272-313 None
5o9z X-ray 4.5 D 272-313 None


© NPIDB team 2003 - 2019

text