Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: Q96DI7
RecName: U5 small nuclear ribonucleoprotein 40 kDa protein
Begin-End: 56-94
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWN
Structures of the domain Q96DI7 56-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 D 226-263 None
3jcr X-ray 7 D 143-180 None
5o9z X-ray 4.5 D 226-263 None
5o9z X-ray 4.5 D 143-180 None


© NPIDB team 2003 - 2019

text