Pfam domain
Pfam family: Fapy_DNA_glyco (PF01149.23)
Uniprot AC: Q96FI4
RecName: Endonuclease 8-like 1
Begin-End: 2-123
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILS
PLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFG
RW
Structures of the domain Q96FI4 2-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5itr X-ray 2.46 A 2-123 None
5itr X-ray 2.46 B 2-123 None
5itr X-ray 2.46 C 2-123 None
5itt X-ray 2.53 A 2-123 None
5itt X-ray 2.53 B 2-123 None
5itt X-ray 2.53 C 2-123 None
5itx X-ray 2.65 A 2-123 None
5itx X-ray 2.65 B 2-123 None
5itx X-ray 2.65 E 3-123 None
5ity X-ray 2.48 A 3-123 None
5ity X-ray 2.48 B 3-123 None
5ity X-ray 2.48 C 3-123 None
5itu X-ray 2.41 A 2-123 None
5itu X-ray 2.41 B 2-123 None
5itu X-ray 2.41 C 2-123 None


© NPIDB team 2003 - 2019

text