Pfam domain
Pfam family: Neil1-DNA_bind (PF09292.9)
Uniprot AC: Q96FI4
RecName: Endonuclease 8-like 1
Begin-End: 252-290
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAP
Structures of the domain Q96FI4 252-290
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5itr X-ray 2.46 A 252-290 None
5itr X-ray 2.46 B 244-290 None
5itr X-ray 2.46 C 252-290 None
5itt X-ray 2.53 A 252-290 None
5itt X-ray 2.53 B 244-290 None
5itt X-ray 2.53 C 252-290 None
5itx X-ray 2.65 A 252-290 None
5itx X-ray 2.65 B 252-290 None
5itx X-ray 2.65 E 252-290 None
5ity X-ray 2.48 A 252-290 None
5ity X-ray 2.48 B 252-290 None
5ity X-ray 2.48 C 252-290 None
5itu X-ray 2.41 A 252-290 None
5itu X-ray 2.41 B 254-290 None
5itu X-ray 2.41 C 252-290 None


© NPIDB team 2003 - 2019

text