Pfam domain
Pfam family: Exo_endo_phos (PF03372.22)
Uniprot AC: Q96LI5
RecName: CCR4-NOT transcription complex subunit 6-like
Begin-End: 192-529
Organism: Homo sapiens
Interaction Mode:   

Sequence:
MCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNCDADIISLQEVETEQYFTLFL
PALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSD
GSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANAHMHWDPEYSDVK
LIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYLSNGGVADN
HKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTNYTFDFKGVIDYI
FYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDH
Structures of the domain Q96LI5 192-529
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ngo X-ray 2.2 A 194-529 None


© NPIDB team 2003 - 2020

text