Pfam domain
Pfam family: YTH (PF04146.14)
Uniprot AC: Q96MU7
RecName: YTH domain-containing protein 1
Begin-End: 355-493
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSARSVILIFSVRESGKFQGFAR
LSSESHHGGSPIHWVLPAGMSAKMLGGVFKIDWICRRELPFTKSAHLTNPWNEHKPVKIG
RDGQEIELECGTQLCLLFP
Structures of the domain Q96MU7 355-493
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4r3i X-ray 1.8 A 355-492 None


© NPIDB team 2003 - 2019

text