Pfam domain
Pfam family: MarR_2 (PF12802.9)
Uniprot AC: Q96ZY1
RecName: Putative MarR family transcriptional regulator
Begin-End: 33-91
Organism: Sulfurisphaera tokodaii
Interaction Mode:  S-Mn L-Bb L-Mn 

Sequence:
LNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRK
Structures of the domain Q96ZY1 33-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3gfi X-ray 2.1 C 35-93 None
3gfi X-ray 2.1 A 35-93  S-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text