Pfam domain
Pfam family: HhH-GPD (PF00730.24)
Uniprot AC: Q97FM4
RecName: 8-oxoguanine-DNA-glycosylase
Begin-End: 120-272
Organism: Clostridium acetobutylicum
Interaction Mode:   

Sequence:
LSFIISANNRIPMIKKCINNISEKAGKKLEYKGKIYYAFPTVDKLHEFTEKDFEECTAGF
RAKYLKDTVDRIYNGELNLEYIKSLNDNECHEELKKFMGVGPKVADCIMLFSMQKYSAFP
VDTWVKKAMMSLYVAPDVSLKKIRDFGREKFGS
Structures of the domain Q97FM4 120-272
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3i0x X-ray 1.8 A 121-261 None
3i0w X-ray 1.73 A 121-261 None


© NPIDB team 2003 - 2019

text