Pfam domain
Pfam family: OGG_N (PF07934.11)
Uniprot AC: Q97FM4
RecName: 8-oxoguanine-DNA-glycosylase
Begin-End: 13-119
Organism: Clostridium acetobutylicum
Interaction Mode:   

Sequence:
VIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEKVVEVQKIGEDVVIYNINEEEFK
NVWSEYFDLYRDYGEIKKELSRDPLLKKSVDFGEGIRILRQDPFEIL
Structures of the domain Q97FM4 13-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3i0x X-ray 1.8 A 17-119 None
3i0w X-ray 1.73 A 17-119 None


© NPIDB team 2003 - 2019

text