Pfam domain
Pfam family: IMS (PF00817.19)
Uniprot AC: Q97W02
RecName: DNA polymerase IV
Begin-End: 6-156
Organism: Sulfolobus solfataricus
Interaction Mode:  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 

Sequence:
VDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAK
KILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLG
LEIKNKILEKEKITVTVGISKNKVFAKIAAD
Structures of the domain Q97W02 6-156
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2bq3 X-ray 2 A 6-155 None
2va3 X-ray 2.98 A 6-155 None
2v4q X-ray 2.6 A 6-155 None
2au0 X-ray 2.7 A 6-155 None
2au0 X-ray 2.7 B 1006-1155 None
2c2r X-ray 2.55 A 6-155 None
2jej X-ray 1.86 A 6-155 None
3khl X-ray 2.1 A 6-155 None
3khl X-ray 2.1 B 1006-1155 None
3qz7 X-ray 2 A 6-155 None
2bqr X-ray 2.37 A 6-155 None
2ia6 X-ray 2.5 B 6-155 None
2ia6 X-ray 2.5 A 6-155 None
1n56 X-ray 2.4 A 6-155 None
1n56 X-ray 2.4 B 6-155 None
2r8g X-ray 2.7 A 6-155 None
2agq X-ray 2.1 A 6-155 None
2agp X-ray 2.9 A 6-155 None
2agp X-ray 2.9 B 6-155 None
2c28 X-ray 2.27 A 6-155 None
1jxl X-ray 2.1 A 6-155 None
2uvr X-ray 2.9 A 6-155 None
3rbd X-ray 2.5 A 6-155  H-Bb 
3rbd X-ray 2.5 B 1006-1155 None
2r8h X-ray 2.48 A 6-155  S-Bb 
2w9a X-ray 2.6 A 6-155 None
3t5l X-ray 2.9 A 6-155 None
2j6t X-ray 2.6 A 6-155 None
1s97 X-ray 2.4 A 6-155 None
1s97 X-ray 2.4 B 6-155 None
1s97 X-ray 2.4 C 6-155 None
1s97 X-ray 2.4 D 6-155 None
2w9c X-ray 2.87 B 6-155 None
2w9c X-ray 2.87 A 6-155 None
3v6k X-ray 3.6 J 6-155 None
3v6k X-ray 3.6 A 6-155 None
2w8l X-ray 3 A 6-155 None
3khg X-ray 2.96 B 1006-1155 None
3khg X-ray 2.96 A 6-155 None
2bqu X-ray 2.5 A 6-155 None
2uvu X-ray 2.7 A 6-155 None
3m9n X-ray 1.93 B 6-155  H-Bb 
2jei X-ray 2.39 A 6-155 None
4gc7 X-ray 2.89 A 6-155 None
4gc7 X-ray 2.89 B 6-155 None
2v9w X-ray 3 A 6-155 None
2v9w X-ray 3 B 6-155 None
2w9b X-ray 2.28 B 6-155 None
2w9b X-ray 2.28 A 6-155 None
2asj X-ray 2.35 A 6-155 None
2asj X-ray 2.35 B 1006-1155 None
2ago X-ray 2.85 A 6-155 None
2xcp X-ray 2.6 B 6-155 None
2xcp X-ray 2.6 A 6-155 None
2br0 X-ray 2.17 A 6-155 None
2jeg X-ray 2.38 A 6-155 None
2rdj X-ray 2.2 B 6-155  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
2rdj X-ray 2.2 A 6-155 None
2uvw X-ray 2.09 A 6-155 None
2c2e X-ray 2.61 A 6-155 None
2c22 X-ray 2.56 A 6-155 None
2w8k X-ray 3.1 A 6-155 None
2xc9 X-ray 2.2 A 6-155 None
2r8i X-ray 2.38 A 6-155 None
3khh X-ray 2.7 B 1006-1155 None
3khh X-ray 2.7 A 6-155 None
1s9f X-ray 2 A 6-155  S-Bb 
1s9f X-ray 2 B 6-155  H-Bb S-Bb L-Bb 
1s9f X-ray 2 C 6-155  S-Bb 
1s9f X-ray 2 D 6-155  H-Bb S-Bb 
3rb3 X-ray 2.8 A 6-155  H-Bb 
2ibk X-ray 2.25 A 6-155 None
2asd X-ray 1.95 A 6-155 None
2asd X-ray 1.95 B 1006-1155 None
3pr5 X-ray 2.4 B 6-155 None
3pr4 X-ray 2.65 A 6-155  H-Bb 
2v4r X-ray 2.5 A 7-156 None
1s0n X-ray 2.8 A 6-155  H-Bb L-Bb 
3qz8 X-ray 2 A 6-155 None
2asl X-ray 2.65 A 6-155 None
2asl X-ray 2.65 B 1006-1155 None
3khr X-ray 2.01 A 6-155 None
3khr X-ray 2.01 B 1006-1155 None
2atl X-ray 2.8 A 6-155 None
2atl X-ray 2.8 B 1006-1155 None
2c2d X-ray 2.57 A 6-155 None
1n48 X-ray 2.2 A 6-155  L-Bb 
3m9o X-ray 2 B 6-155  H-Bb 
3pvx X-ray 3.03 A 6-155 None
3pw2 X-ray 2.74 A 7-156 None
3pw0 X-ray 2.91 A 6-155 None
3gik X-ray 2.9 A 6-155 None
3gij X-ray 2.4 A 6-155  H-Bb 
3gij X-ray 2.4 B 1006-1155 None
3gii X-ray 2.6 A 6-155  H-Bb 
1jx4 X-ray 1.7 A 6-155 None
2xca X-ray 2.5 A 6-155 None
1ryr X-ray 2.28 A 6-155 None
3rax X-ray 1.89 B 1006-1155 None
3rax X-ray 1.89 A 6-155 None
3v6j X-ray 2.3 J 6-155 None
3v6j X-ray 2.3 A 6-155 None
3gim X-ray 2.7 A 6-155 None
3v6h X-ray 2.3 A 6-155 None
3v6h X-ray 2.3 B 6-155 None
2va2 X-ray 2.8 B 6-155 None
2va2 X-ray 2.8 A 6-155 None
2jef X-ray 2.17 A 6-155 None
4gc6 X-ray 2.9 A 6-155  H-Bb S-Bb L-Bb 
3t5h X-ray 2.35 A 6-155 None
3t5j X-ray 2.4 A 6-155 None
3t5k X-ray 2.9 A 6-155 None
3rb6 X-ray 2.7 B 1006-1155 None
3rb6 X-ray 2.7 A 6-155 None
3rb0 X-ray 3.23 A 6-155  H-Bb 
3rb0 X-ray 3.23 B 1006-1155 None
3raq X-ray 2.25 A 6-155 None
3raq X-ray 2.25 B 1006-1155 None
3rbe X-ray 2.8 A 6-155 None
3rbe X-ray 2.8 B 1006-1155 None
3rb4 X-ray 2.81 A 6-155  H-Bb 
3rb4 X-ray 2.81 B 1006-1155 None
4g3i X-ray 2.5 A 6-155 None
4g3i X-ray 2.5 B 6-155 None
4jv1 X-ray 2.3 A 6-155  S-Bb 
4juz X-ray 2.65 A 6-155 None
4jv2 X-ray 2.74 A 6-155  H-Bb 
4jv0 X-ray 2.95 A 6-155 None
4fbt X-ray 2 A 6-155 None
4fbu X-ray 2.6 A 6-155  H-Bb S-Bb S-Mj S-Mn L-Mj 
4fbu X-ray 2.6 B 6-155  H-Bb S-Bb S-Mj S-Mn L-Mj 
1rys X-ray 2.03 A 6-155 None
1rys X-ray 2.03 B 6-155  H-Bb L-Bb 
4qw9 X-ray 2.4 A 6-155  H-Bb 
4qwc X-ray 2.4 D 6-155 None
4qwc X-ray 2.4 A 6-155 None
4qwa X-ray 2.2 A 6-155  H-Bb 
4qwb X-ray 1.8 A 6-155  H-Bb 
4qwe X-ray 2.2 A 6-155  H-Bb S-Bb L-Bb 
4qwd X-ray 2.05 A 6-155  H-Bb L-Bb 
4qw8 X-ray 2.29 A 6-155  H-Bb 
4tqr X-ray 1.58 A 6-155 None
4f4z X-ray 2.31 B 6-155  L-Bb L-Mj L-Mn 
4f4z X-ray 2.31 A 6-155  H-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
4rua X-ray 3.07 A 6-155 None
4ruc X-ray 2.9 A 6-155 None
1s10 X-ray 2.1 A 6-155 None
2j6u X-ray 2.5 A 9-158 None
3m9m X-ray 2.9 B 6-155 None
4rzr X-ray 2.2 D 6-155  H-Bb 
4rzr X-ray 2.2 A 6-155 None
3gil X-ray 2.71 A 6-155 None
3gil X-ray 2.71 B 1006-1155 None
5edw X-ray 2.62 A 6-155 None
1s0m X-ray 2.7 A 6-155 None
1s0m X-ray 2.7 B 6-155 None
1s0o X-ray 2.1 A 6-155 None
1s0o X-ray 2.1 B 6-155 None
2uvv X-ray 2.2 A 6-155 None
4tqs X-ray 2.06 B 6-155 None
4tqs X-ray 2.06 A 6-155  L-Bb 
2j6s X-ray 2.5 A 6-155 None
2imw X-ray 2.05 P 6-155  S-Bb L-Bb 


© NPIDB team 2003 - 2019

text